PDB entry 2aa1

View 2aa1 on RCSB PDB site
Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi
Class: oxygen storage/transport
Keywords: hemoglobin, Root effect, cooperativity, Antarctic fish, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2005-07-13, released 2005-08-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha-1 chain
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aa1a_
  • Chain 'B':
    Compound: Hemoglobin beta-C chain
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aa1b1
  • Chain 'C':
    Compound: Hemoglobin alpha-1 chain
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aa1c_
  • Chain 'D':
    Compound: Hemoglobin beta-C chain
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aa1d_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aa1A (A:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aa1B (B:)
    vewtdferatikdifskleydvvgpatlarclvvypwtqryfgkfgnlynaaaiaqnamv
    skhgttilngldravknmdditntyaelsvlhseklhvdpdnfklladcltivvaarfgs
    aftgevqaafqkfmavvvsslgkqyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aa1C (C:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aa1D (D:)
    vewtdferatikdifskleydvvgpatlarclvvypwtqryfgkfgnlynaaaiaqnamv
    skhgttilngldravknmdditntyaelsvlhseklhvdpdnfklladcltivvaarfgs
    aftgevqaafqkfmavvvsslgkqyr