PDB entry 2aa1

View 2aa1 on RCSB PDB site
Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi
Class: oxygen storage/transport
Keywords: hemoglobin, Root effect, cooperativity, Antarctic fish
Deposited on 2005-07-13, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hemoglobin alpha-1 chain
  Species: Trematomus newnesi
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45718 (0-141)
  Domains in SCOP 1.73: d2aa1a1
• Chain 'B':
  Compound: Hemoglobin beta-C chain
  Species: Trematomus newnesi
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45721 (0-145)
• Chain 'C':
  Compound: Hemoglobin alpha-1 chain
  Species: Trematomus newnesi
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45718 (0-141)
  Domains in SCOP 1.73: d2aa1c1
• Chain 'D':
  Compound: Hemoglobin beta-C chain
  Species: Trematomus newnesi
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45721 (0-145)
• Heterogens: ACE, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aa1A (A:)
  slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
  kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
  eahvsldkflsgvalalaeryr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aa1C (C:)
  slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
  kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
  eahvsldkflsgvalalaeryr
  

  
  
• Chain 'D':
  No sequence available.