PDB entry 2a9z

View 2a9z on RCSB PDB site
Description: Crystal structure of T. gondii adenosine kinase complexed with N6-dimethyladenosine and AMP-PCP
Class: signaling protein,transferase
Keywords: ribokinase fold; alpha/beta; intermediate conformation, SIGNALING PROTEIN,TRANSFERASE
Deposited on 2005-07-12, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.137
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: AK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TVW2
      • engineered (289)
      • engineered (379)
    Domains in SCOPe 2.07: d2a9za_
  • Heterogens: CL, NA, 26A, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9zA (A:)
    mgsshhhhhhssglvprgshmavdssnsatgpmrvfaignpildlvaevpssfldefflk
    rgdatlatpeqmriystldqfnptslpggsalnsvrvvqkllrkpgsagymgaigddprg
    qvlkelcdkeglatrfmvapgqstgvcavlinekertlcthlgacgsfrlpedwttfasg
    alifyataytltatpknalevagyahgipnaiftlnlsapfcvelykdamqslllhtnil
    fgneeefahlakvhnlvaaektalstankehavevctgalrlltagqntsatklvvmtrg
    hnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggflyalsqgktvkqcimc
    gnacaqdviqhvgfslsftftsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9zA (A:)
    tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg
    salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav
    linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknalevagyahgip
    naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaektalstank
    ehavevctgalrlltagqntsatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaek
    ivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsftf