PDB entry 2a9y

View 2a9y on RCSB PDB site
Description: Crystal structure of T. gondii adenosine kinase complexed with N6-dimethyladenosine
Class: signaling protein,transferase
Keywords: ribokinase fold; alpha/beta
Deposited on 2005-07-12, released 2006-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.133
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Toxoplasma gondii
    Gene: AK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TVW2
      • engineered (289)
      • engineered (379)
    Domains in SCOP 1.73: d2a9ya1
  • Heterogens: CL, NA, ACT, 26A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9yA (A:)
    mgsshhhhhhssglvprgshmavdssnsatgpmrvfaignpildlvaevpssfldefflk
    rgdatlatpeqmriystldqfnptslpggsalnsvrvvqkllrkpgsagymgaigddprg
    qvlkelcdkeglatrfmvapgqstgvcavlinekertlcthlgacgsfrlpedwttfasg
    alifyataytltatpknalevagyahgipnaiftlnlsapfcvelykdamqslllhtnil
    fgneeefahlakvhnlvaaektalstankehavevctgalrlltagqntsatklvvmtrg
    hnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggflyalsqgktvkqcimc
    gnacaqdviqhvgfslsftftsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9yA (A:)
    tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg
    salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav
    linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknalevagyahgip
    naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaektalstank
    ehavevctgalrlltagqntsatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaek
    ivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsftf