PDB entry 2a9v

View 2a9v on RCSB PDB site
Description: Crystal structure of a putative gmp synthase subunit a protein (ta0944m) from thermoplasma acidophilum at 2.45 A resolution
Class: ligase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, ligase
Deposited on 2005-07-12, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.176
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GMP synthase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: guaAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HJM3 (12-End)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (121)
    Domains in SCOPe 2.07: d2a9va1, d2a9va2
  • Chain 'B':
    Compound: GMP synthase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: guaAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HJM3 (12-End)
      • modified residue (12)
      • modified residue (121)
    Domains in SCOPe 2.07: d2a9vb_
  • Chain 'C':
    Compound: GMP synthase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: guaAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HJM3 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (121)
    Domains in SCOPe 2.07: d2a9vc2, d2a9vc3
  • Chain 'D':
    Compound: GMP synthase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: guaAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HJM3 (12-End)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (121)
    Domains in SCOPe 2.07: d2a9vd2, d2a9vd3
  • Heterogens: CL, SCN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9vA (A:)
    mgsdkihhhhhhmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvl
    sggapnideeldklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvs
    vmhsenifgglpseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhp
    evehtqygrdifrnfigicasyreiqkenfqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9vA (A:)
    hhhmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnide
    eldklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifg
    glpseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygr
    difrnfigicasyreiqke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a9vB (B:)
    mgsdkihhhhhhmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvl
    sggapnideeldklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvs
    vmhsenifgglpseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhp
    evehtqygrdifrnfigicasyreiqkenfqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9vB (B:)
    mlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnideeld
    klgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifgglp
    seitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygrdif
    rnfigicasyreiqken
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a9vC (C:)
    mgsdkihhhhhhmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvl
    sggapnideeldklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvs
    vmhsenifgglpseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhp
    evehtqygrdifrnfigicasyreiqkenfqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9vC (C:)
    hmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnideel
    dklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifggl
    pseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygrdi
    frnfigicasyreiqkenf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a9vD (D:)
    mgsdkihhhhhhmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvl
    sggapnideeldklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvs
    vmhsenifgglpseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhp
    evehtqygrdifrnfigicasyreiqkenfqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9vD (D:)
    hhhmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnide
    eldklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifg
    glpseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygr
    difrnfigicasyreiqkenf