PDB entry 2a9u

View 2a9u on RCSB PDB site
Description: Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)
Class: hydrolase
Keywords: coil-coil, Hydrolase, Protease, SH3-binding, Thiol protease, Ubl conjugation pathway, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-07-12, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 8
    Species: HOMO SAPIENS
    Gene: USP8, KIAA0055, UBPY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40818
      • modified residue (65)
    Domains in SCOP 1.73: d2a9ua1
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 8
    Species: HOMO SAPIENS
    Gene: USP8, KIAA0055, UBPY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40818
      • modified residue (65)
    Domains in SCOP 1.73: d2a9ub1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9uA (A:)
    gsmpavasvpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeer
    ayvlymkyvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaev
    rkkleekdrqeeaqrlqqkrqetg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9uA (A:)
    svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
    yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
    drqeeaqrlqqkrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a9uB (B:)
    gsmpavasvpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeer
    ayvlymkyvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaev
    rkkleekdrqeeaqrlqqkrqetg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9uB (B:)
    svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
    yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
    drqeeaq