PDB entry 2a9q

View 2a9q on RCSB PDB site
Description: low resolution structure rr02-rec on bef3 bound
Deposited on 2005-07-12, released 2006-09-26
Made obsolete by 6ebb on 2019-08-14

The last revision was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2a9qA (A:)
    mkkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidg
    levaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrsq
    

    Sequence, based on observed residues (ATOM records):
    >2a9qA (A:)
    kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildldglevakt
    irktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr