PDB entry 2a9i

View 2a9i on RCSB PDB site
Description: Molecular Structure of the Interleukin-1 Receptor-Associated Kinase-4 Death Domain
Class: Transferase
Keywords: hexahelical bundle, Transferase
Deposited on 2005-07-11, released 2005-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-1 receptor-associated kinase-4
    Species: Mus musculus [TaxId:10090]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R4K2
      • conflict (63)
    Domains in SCOPe 2.06: d2a9ia_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9iA (A:)
    mnkpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhirrfeall
    qtglsptcellfdwgttnctvgdlvdllvqielfapatlllpdavpqtvkslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9iA (A:)
    kpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhirrfeallqt
    glsptcellfdwgttnctvgdlvdllvqielfapatlllpdavpq