PDB entry 2a9h

View 2a9h on RCSB PDB site
Description: NMR structural studies of a potassium channel / charybdotoxin complex
Class: METAL TRANSPORT, membrane protein
Keywords: Potassium channel, KcsA, NMR, structure, membrane protein, METAL TRANSPORT
Deposited on 2005-07-11, released 2006-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (80)
      • engineered (83)
      • engineered (86)
      • engineered (112)
      • engineered (125)
      • engineered (129)
      • engineered (132)
    Domains in SCOPe 2.06: d2a9ha1
  • Chain 'B':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (80)
      • engineered (83)
      • engineered (86)
      • engineered (112)
      • engineered (125)
      • engineered (129)
      • engineered (132)
    Domains in SCOPe 2.06: d2a9hb_
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (80)
      • engineered (83)
      • engineered (86)
      • engineered (112)
      • engineered (125)
      • engineered (129)
      • engineered (132)
    Domains in SCOPe 2.06: d2a9hc_
  • Chain 'D':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (80)
      • engineered (83)
      • engineered (86)
      • engineered (112)
      • engineered (125)
      • engineered (129)
      • engineered (132)
    Domains in SCOPe 2.06: d2a9hd_
  • Chain 'E':
    Compound: charybdotoxin
    Database cross-references and differences (RAF-indexed):
    • PDB 2A9H (0-36)
    Domains in SCOPe 2.06: d2a9he1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9hA (A:)
    msgshhhhhhssgiegrgrlikhmppmlsgllarlvklllgrhgsalhwraagaatvllv
    ivllagsylavlaergapgaalisypdalwwsvetattvgygdlypvtlwgrcvavvvmv
    agitsyglvfaavatwfvgreqerrghfvrhseka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9hA (A:)
    alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a9hB (B:)
    msgshhhhhhssgiegrgrlikhmppmlsgllarlvklllgrhgsalhwraagaatvllv
    ivllagsylavlaergapgaalisypdalwwsvetattvgygdlypvtlwgrcvavvvmv
    agitsyglvfaavatwfvgreqerrghfvrhseka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9hB (B:)
    alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a9hC (C:)
    msgshhhhhhssgiegrgrlikhmppmlsgllarlvklllgrhgsalhwraagaatvllv
    ivllagsylavlaergapgaalisypdalwwsvetattvgygdlypvtlwgrcvavvvmv
    agitsyglvfaavatwfvgreqerrghfvrhseka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9hC (C:)
    alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a9hD (D:)
    msgshhhhhhssgiegrgrlikhmppmlsgllarlvklllgrhgsalhwraagaatvllv
    ivllagsylavlaergapgaalisypdalwwsvetattvgygdlypvtlwgrcvavvvmv
    agitsyglvfaavatwfvgreqerrghfvrhseka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9hD (D:)
    alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a9hE (E:)
    eftnvscttskecwsvcqrlhntsrgkcmnkkcrcys