PDB entry 2a9g

View 2a9g on RCSB PDB site
Description: Structure of C406A arginine deiminase in complex with L-arginine
Class: hydrolase
Keywords: arginine degradation pathway, L-arginine deiminase, X-ray structure, catalytic mechanism
Deposited on 2005-07-11, released 2005-08-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (405)
    Domains in SCOP 1.73: d2a9ga1
  • Chain 'B':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (405)
    Domains in SCOP 1.73: d2a9gb1
  • Chain 'C':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (405)
    Domains in SCOP 1.73: d2a9gc1
  • Chain 'D':
    Compound: Arginine deiminase
    Species: PSEUDOMONAS AERUGINOSA
    Gene: arcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • engineered (405)
    Domains in SCOP 1.73: d2a9gd1
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9gA (A:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghamtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9gA (A:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
    drntytntllrkagvevitisaselgrgrggghamtcpivrdpid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a9gB (B:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghamtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9gB (B:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksrmhldtvfsfcdrdlvtvfpevvkeivpfslr
    pdpsspygmnirreektflevvaeslglkklrvvetgaaereqwddgnnvvclepgvvvg
    ydrntytntllrkagvevitisaselgrgrggghamtcpivrdpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a9gC (C:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghamtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9gC (C:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpkamhldtvfsfcdrdlvtvfpevvkeivpfslrp
    dpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgydrn
    tytntllrkagvevitisaselgrgrggghamtcpivrdpid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a9gD (D:)
    mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvt
    kmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprkla
    eyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpm
    ywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligm
    gerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvke
    ivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnn
    vvclepgvvvgydrntytntllrkagvevitisaselgrgrggghamtcpivrdpidy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9gD (D:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetggreqwddgnnvvclepgvvvg
    ydrntytntllrkagvevitisaselgrgrggghamtcpivrdpid