PDB entry 2a9f

View 2a9f on RCSB PDB site
Description: Crystal structure of a putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
Class: structural genomics, unknown function
Keywords: Hypothetical protein, putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)), Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2005-07-11, released 2005-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.26
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99ZS1 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d2a9fa1, d2a9fa2, d2a9fa3
  • Chain 'B':
    Compound: putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99ZS1 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d2a9fb1, d2a9fb2, d2a9fb3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9fA (A:)
    mslknqlgqlaleqaktfggklevqpkvdiktkhdlsiaytpgvasvssaiakdktlayd
    lttkkntvavisdgtavlglgdigpeaampvmegkaalfkafagvdaipivldtkdteei
    isivkalaptfgginledisaprcfeieqrlikechipvfhddqhgtaivvlaaifnslk
    llkksldevsivvngggsaglsitrkllaagatkvtvvdkfgiineqeaaqlaphhldia
    kvtnrefksgtledalegadifigvsapgvlkaewiskmaarpvifamanpipeiypdea
    leagayivgtgrsdfpnqinnvlafpgifrgaldaraktitvemqiaaakgiaslvpdda
    lsttniipdafkegvaeivaksvrsvvlkseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9fA (A:)
    lknqlgqlaleqaktfggklevqpkvdiktkhdlsiaytpgvasvssaiakdktlaydlt
    tkkntvavisdgtavlglgdigpeaampvmegkaalfkafagvdaipivldtkdteeiis
    ivkalaptfgginledisaprcfeieqrlikechipvfhddqhgtaivvlaaifnslkll
    kksldevsivvngggsaglsitrkllaagatkvtvvdkfgiineqeaaqlapdiakvtnr
    efksgtledalegadifigvsapgvlkaewiskmaarpvifamanpipeiypdealeaga
    yivgtgrsdfpnqinnvlafpgifrgaldaraktitvemqiaaakgiaslvpddalsttn
    iipdafkegvaeivaksvrsvvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a9fB (B:)
    mslknqlgqlaleqaktfggklevqpkvdiktkhdlsiaytpgvasvssaiakdktlayd
    lttkkntvavisdgtavlglgdigpeaampvmegkaalfkafagvdaipivldtkdteei
    isivkalaptfgginledisaprcfeieqrlikechipvfhddqhgtaivvlaaifnslk
    llkksldevsivvngggsaglsitrkllaagatkvtvvdkfgiineqeaaqlaphhldia
    kvtnrefksgtledalegadifigvsapgvlkaewiskmaarpvifamanpipeiypdea
    leagayivgtgrsdfpnqinnvlafpgifrgaldaraktitvemqiaaakgiaslvpdda
    lsttniipdafkegvaeivaksvrsvvlkseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9fB (B:)
    lknqlgqlaleqaktfggklevqpkvdiktkhdlsiaytpgvasvssaiakdktlaydlt
    tkkntvavisdgtavlglgdigpeaampvmegkaalfkafagvdaipivldtkdteeiis
    ivkalaptfgginledisaprcfeieqrlikechipvfhddqhgtaivvlaaifnslkll
    kksldevsivvngggsaglsitrkllaagatkvtvvdkfgiineqeaaqlapdiakvtnr
    efksgtledalegadifigvsapgvlkaewiskmaarpvifamanpipeiypdealeaga
    yivgtgrsdfpnqinnvlafpgifrgaldaraktitvemqiaaakgiaslvpddalsttn
    iipdafkegvaeivaksvrs