PDB entry 2a9e

View 2a9e on RCSB PDB site
Description: Helicobacter pylori catalase compound I
Class: oxidoreductase
Keywords: beta barrel, oxoferryl heme, OXIDOREDUCTASE
Deposited on 2005-07-11, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.139
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KatA Catalase
    Species: Helicobacter pylori [TaxId:210]
    Gene: katA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77872 (0-End)
      • modified residue (161)
      • modified residue (180)
      • modified residue (291)
      • modified residue (371)
    Domains in SCOPe 2.07: d2a9ea_
  • Chain 'B':
    Compound: KatA Catalase
    Species: Helicobacter pylori [TaxId:210]
    Gene: katA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77872 (0-End)
      • modified residue (161)
      • modified residue (180)
      • modified residue (291)
      • modified residue (371)
    Domains in SCOPe 2.07: d2a9eb_
  • Heterogens: ACT, HEM, O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9eA (A:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmkdmhgkdmhhtkkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9eA (A:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a9eB (B:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmkdmhgkdmhhtkkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9eB (B:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmk