PDB entry 2a9c

View 2a9c on RCSB PDB site
Description: Crystal structure of R138Q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
Class: oxidoreductase
Keywords: sulfite oxidase; Molybdopterin; Molybdenum; CSO; sulfate; R138Q; R160Q, OXIDOREDUCTASE
Deposited on 2005-07-11, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.16
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite oxidase
    Species: Gallus gallus [TaxId:9031]
    Gene: SUOX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07850 (Start-371)
      • engineered (43)
    Domains in SCOPe 2.08: d2a9ca1, d2a9ca2
  • Chain 'B':
    Compound: sulfite oxidase
    Species: Gallus gallus [TaxId:9031]
    Gene: SUOX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07850 (Start-371)
      • engineered (43)
    Domains in SCOPe 2.08: d2a9cb1, d2a9cb2
  • Heterogens: SO4, MTE, MO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a9cA (A:)
    dpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlr
    vdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarw
    ggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllayem
    ngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtv
    dyrtapaiqelpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkv
    arlmgdkappgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvls
    tawhrvrvsvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9cA (A:)
    rvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlrvdgpgggtlslsl
    aelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhag
    fpeelqgewhvcfegldadpggapygasipygralspaadvllayemngtelprdhgfpv
    rvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiqelpv
    qsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgra
    wawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a9cB (B:)
    dpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlr
    vdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarw
    ggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllayem
    ngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtv
    dyrtapaiqelpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkv
    arlmgdkappgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvls
    tawhrvrvsvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a9cB (B:)
    rvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlrvdgpgggtlslsl
    aelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhag
    fpeelqgewhvcfegldadpggapygasipygralspaadvllayemngtelprdhgfpv
    rvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiqelpv
    qsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgra
    wawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd