PDB entry 2a9b

View 2a9b on RCSB PDB site
Description: Crystal structure of R138Q mutant of recombinant sulfite oxidase at resting state
Class: oxidoreductase
Keywords: sulfite oxidase; molybdopterin; molybdenum; mutant; R160Q, R138Q
Deposited on 2005-07-11, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.158
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite oxidase
    Species: GALLUS GALLUS
    Gene: SUOX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07850 (0-371)
      • engineered (43)
    Domains in SCOP 1.73: d2a9ba1, d2a9ba2
  • Heterogens: CL, MTE, MO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a9bA (A:)
    dpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlr
    vdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarw
    ggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllayem
    ngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtv
    dyrtapaiqelpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkv
    arlmgdkappgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvls
    tawhrvrvsvqd