PDB entry 2a8w

View 2a8w on RCSB PDB site
Description: Crystal Structure of Human N-acetylgalactosaminyltransferase (GTA) Complexed with Beta-Methyllactoside
Class: transferase
Keywords: GTA, ABO(H), blood groups, glycosyltransferase, retaining, TRANSFERASE
Deposited on 2005-07-09, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.21
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase (NAGAT) [Includes: Glycoprotein-fucosylgalactoside alpha-N- acetylgalactosaminyltransferase (EC 2.4.1.40) (Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase) (Histo-blood group A transferase) (A transferase); Glycoprotein-fucosylgalactoside alpha- galactosyltransferase (EC 2.4.1.37) (Fucosylglycoprotein 3-alpha- galactosyltransferase) (Histo-blood group B transferase) (B transferase)] [Contains: Fucosylglycoprotein alpha-N- acetylgalactosaminyltransferase, soluble form]
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2a8wa2, d2a8wa3
  • Heterogens: HG, CL, MN, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a8wA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrw
    qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssr
    eaftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwh
    deshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8wA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvleverrfls
    evdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftyerrpqsqayipkdegd
    fyylggffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
    ylwdqqllgwpavlrklrftavp