PDB entry 2a8v

View 2a8v on RCSB PDB site
Description: rho transcription termination factor/RNA complex
Class: protein/RNA
Keywords: rho, ob fold, single-stranded nucleic acid binding domain, protein/RNA complex
Deposited on 1998-11-08, released 1999-04-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA binding domain of rho transcription termination factor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a8va1, d2a8va2
  • Chain 'B':
    Compound: RNA binding domain of rho transcription termination factor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a8vb1, d2a8vb2
  • Chain 'C':
    Compound: RNA binding domain of rho transcription termination factor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2a8vc1, d2a8vc2
  • Chain 'D':
    Compound: 5'-r(p*cp*cp*c)-3'
    Species: Escherichia coli [TaxId:562]
  • Chain 'E':
    Compound: 5'-r(p*cp*cp*cp*cp*cp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a8vA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a8vB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a8vC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.