PDB entry 2a8q

View 2a8q on RCSB PDB site
Description: 2.6 Angstrom Crystal Structure of the Complex Between the Nuclear SnoRNA Decapping Nudix Hydrolase X29 and Manganese in the Presence of 7-methyl-GDP
Class: translation,hydrolase
Keywords: modified nudix hydrolase fold, TRANSLATION, HYDROLASE
Deposited on 2005-07-08, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U8 snoRNA-binding protein X29
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q569R2
      • modified residue (173)
    Domains in SCOPe 2.08: d2a8qa_
  • Chain 'B':
    Compound: U8 snoRNA-binding protein X29
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q569R2
      • modified residue (173)
    Domains in SCOPe 2.08: d2a8qb_
  • Heterogens: MN, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a8qA (A:)
    maesrspdrgakedkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllm
    mmrfdgrlgfpggfvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkc
    vthfyikelkleeierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfign
    sksqllyalrslkllredqiqevlkashrlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8qA (A:)
    prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvrd
    isleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieriea
    eavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllredq
    iqevlkashr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a8qB (B:)
    maesrspdrgakedkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllm
    mmrfdgrlgfpggfvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkc
    vthfyikelkleeierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfign
    sksqllyalrslkllredqiqevlkashrlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8qB (B:)
    prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
    rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
    eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
    dqiqevlkash