PDB entry 2a8n

View 2a8n on RCSB PDB site
Description: Biochemical and Structural Studies of A-to-I Editing by tRNA:A34 Deaminases at the Wobble Position of Transfer RNA
Class: RNA binding protein
Keywords: RNA Editing, RNA BINDING PROTEIN
Deposited on 2005-07-08, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.225
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytidine and deoxycytidylate deaminase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: codA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a8na1
  • Chain 'B':
    Compound: cytidine and deoxycytidylate deaminase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: codA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a8nb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a8nA (A:)
    maerthfmelalvearsagerdevpigavlvldgrviarsgnrtrelndvtahaeiavir
    macealgqerlpgadlyvtlepctmcaaaisfarirrlyygaqdpkggavesgvrffsqp
    tchhapdvysglaesesaeilrqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8nA (A:)
    aerthfmelalvearsagerdevpigavlvldgrviarsgnrtrelndvtahaeiavirm
    acealgqerlpgadlyvtlepctmcaaaisfarirrlyygaqdpkggavesgvrffsqpt
    chhapdvysg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a8nB (B:)
    maerthfmelalvearsagerdevpigavlvldgrviarsgnrtrelndvtahaeiavir
    macealgqerlpgadlyvtlepctmcaaaisfarirrlyygaqdpkggavesgvrffsqp
    tchhapdvysglaesesaeilrqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8nB (B:)
    rthfmelalvearsagerdevpigavlvldgrviarsgnrtrelndvtahaeiavirmac
    ealgqerlpgadlyvtlepctmcaaaisfarirrlyygaqdpkggavesgvrffsqptch
    hapdvysglaesesaeil