PDB entry 2a8k

View 2a8k on RCSB PDB site
Description: Structural and Mutational Studies of the Catalytic Domain of Colicin E5a tRNA-Specific Ribonuclease
Class: hydrolase
Keywords: Ribonuclease, Toxin, HYDROLASE
Deposited on 2005-07-08, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.217
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colicin E5
    Species: Escherichia coli [TaxId:562]
    Gene: col
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a8ka1
  • Chain 'B':
    Compound: Colicin E5
    Species: Escherichia coli [TaxId:562]
    Gene: col
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a8kb_
  • Chain 'C':
    Compound: Colicin E5
    Species: Escherichia coli [TaxId:562]
    Gene: col
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a8kc_
  • Chain 'D':
    Compound: Colicin E5
    Species: Escherichia coli [TaxId:562]
    Gene: col
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a8kd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a8kA (A:)
    mlaknkgkipglkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgr
    ndpatvygspgkyvvvndrtgevtqisdktdpgwvddsriqwgnkndq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8kA (A:)
    lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
    kyvvvndrtgevtqisdktdpgwvddsriqwgnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a8kB (B:)
    mlaknkgkipglkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgr
    ndpatvygspgkyvvvndrtgevtqisdktdpgwvddsriqwgnkndq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8kB (B:)
    lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
    kyvvvndrtgevtqisdktdpgwvddsriqwgnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a8kC (C:)
    mlaknkgkipglkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgr
    ndpatvygspgkyvvvndrtgevtqisdktdpgwvddsriqwgnkndq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8kC (C:)
    lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
    kyvvvndrtgevtqisdktdpgwvddsriqwgnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a8kD (D:)
    mlaknkgkipglkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgr
    ndpatvygspgkyvvvndrtgevtqisdktdpgwvddsriqwgnkndq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8kD (D:)
    lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
    kyvvvndrtgevtqisdktdpgwvddsriqwgnk