PDB entry 2a8g

View 2a8g on RCSB PDB site
Description: Structure of Avidin in complex with the ligand deoxyguanosine
Class: unknown function
Keywords: Beta barrel, UNKNOWN FUNCTION
Deposited on 2005-07-08, released 2006-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.232
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-End)
      • variant (31)
    Domains in SCOPe 2.06: d2a8ga_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-End)
      • variant (31)
    Domains in SCOPe 2.06: d2a8gb_
  • Heterogens: NAG, GNG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a8gA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    lrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8gA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a8gB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    lrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8gB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l