PDB entry 2a8e

View 2a8e on RCSB PDB site
Description: Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.
Class: structural genomics, unknown function
Keywords: X-Ray, NESG, Q45498, yktB, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-07-07, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein yktB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yktB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45498
      • modified residue (3)
      • modified residue (22)
      • modified residue (52)
      • modified residue (148)
      • modified residue (182)
    Domains in SCOPe 2.07: d2a8ea1
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a8eA (A:)
    mtqmrfteedfntftiegldarmevlketvrpkltalgehfaptlsaltgdemfphvakh
    arrsvnppadswvafanskrgykklphfqiglweshvfvwfaiiyespikeeygkllevn
    qetitknipdsfvwsadhtkpgvhkqsemdkeqlktlferlqtvkkaellcgiqlqkeev
    lnmnnqeflqriddafkqlaflyrltqkvtqalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a8eA (A:)
    tqmrfteedfntftiegldarmevlketvrpkltalgehfaptlsaltgdemfphvakha
    rrsvnppadswvafanskrgykklphfqiglweshvfvwfaiiyespikeeygkllevnq
    etitknipdsfvwsadhtkpgvhkqsemdkeqlktlferlqtvkkaellcgiqlqkeevl
    nmnnqeflqriddafkqlaflyrltqkvtq