PDB entry 2a86

View 2a86 on RCSB PDB site
Description: Crystal structure of A Pantothenate synthetase complexed with AMP and beta-alanine
Class: ligase
Keywords: protein-substrate complex, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, LIGASE
Deposited on 2005-07-07, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.161
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantoate--beta-alanine ligase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5R0
      • engineered (76)
    Domains in SCOPe 2.07: d2a86a_
  • Chain 'B':
    Compound: Pantoate--beta-alanine ligase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5R0
      • engineered (1)
    Domains in SCOPe 2.07: d2a86b_
  • Heterogens: SO4, AMP, BAL, GOL, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a86A (A:)
    maipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgs
    vvvvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqp
    gplaaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldva
    vvgvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravld
    aapgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtfagtdrpdgyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a86A (A:)
    ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
    vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
    laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
    gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
    pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a86B (B:)
    maipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgs
    vvvvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqp
    gplaaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldva
    vvgvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravld
    aapgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtfagtdrpdgyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a86B (B:)
    aipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsv
    vvvsifvnpmqfrtpdddlaqlraegveiaftpttaamypdglrttvqpgplaaeleggp
    rpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvgvptvread
    glamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaapgvavdyle
    lrdiglgpmplngsgrllvaarlgttrlldniaieig