PDB entry 2a7y

View 2a7y on RCSB PDB site
Description: Solution Structure of the Conserved Hypothetical Protein Rv2302 from the Bacterium Mycobacterium tuberculosis
Class: structural genomics, unknown function
Keywords: anti-parallel beta sheet, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION
Deposited on 2005-07-06, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv2302/MT2359
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2302
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a7ya1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a7yA (A:)
    gshmhakvgdylvvkgttterhdqhaeiievrsadgsppyvvrwlvnghettvypgsdav
    vvtatehaeaekraaaraghaat
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7yA (A:)
    mhakvgdylvvkgttterhdqhaeiievrsadgsppyvvrwlvnghettvypgsdavvvt
    atehaeaekraaaraghaat