PDB entry 2a7u

View 2a7u on RCSB PDB site
Description: NMR solution structure of the E.coli F-ATPase delta subunit N-terminal domain in complex with alpha subunit N-terminal 22 residues
Class: hydrolase
Keywords: alpha helix bundle, HYDROLASE
Deposited on 2005-07-06, released 2005-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase alpha chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase delta chain
    Species: Escherichia coli [TaxId:83334]
    Gene: atpH, papE, uncH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a7ub1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a7uB (B:)
    sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
    iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseataevdvisaaalseqq
    lakisaamekrlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7uB (B:)
    sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
    iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat