PDB entry 2a7i

View 2a7i on RCSB PDB site
Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength
Class: plant protein
Keywords: Test-modifying protein, PLANT PROTEIN
Deposited on 2005-07-05, released 2005-07-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.196
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: thaumatin I
    Species: THAUMATOCOCCUS DANIELLII [TaxId:4621]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02883 (0-206)
      • see remark 999 (45)
      • see remark 999 (112)
    Domains in SCOPe 2.05: d2a7ix_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a7iX (X:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta