PDB entry 2a7b

View 2a7b on RCSB PDB site
Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength
Class: endocytosis/exocytosis
Keywords: Protein transport
Deposited on 2005-07-05, released 2005-07-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-adaptin appendage domain
    Species: MUS MUSCULUS
    Gene: Ap1g1, Adtg, Clapg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22892 (1-119)
      • initiating methionine (0)
    Domains in SCOP 1.75: d2a7ba1
  • Heterogens: XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a7bA (A:)
    mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
    lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq