PDB entry 2a77

View 2a77 on RCSB PDB site
Description: Anti-Cocaine Antibody 7.5.21, Crystal Form II
Class: immune system
Keywords: Immune System
Deposited on 2005-07-04, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A77 (0-221)
    Domains in SCOPe 2.07: d2a77h1
  • Chain 'L':
    Compound: immunoglobulin light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A77 (0-215)
    Domains in SCOPe 2.07: d2a77l1, d2a77l2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2a77H (H:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddygkspyffdvwgagttvta
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a77H (H:)
    dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
    pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddypyffdvwgagttvtassa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2a77L (L:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgkspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a77L (L:)
    dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgkspklliykvsnrf
    sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktspivksfnr