PDB entry 2a75

View 2a75 on RCSB PDB site
Description: Trypanosoma rangeli Sialidase In Complex With 2,3- Difluorosialic Acid (Covalent Intermediate)
Class: hydrolase
Keywords: beta-propeller, covalent enzyme-intermediate complex, beta-sandwich, HYDROLASE
Deposited on 2005-07-04, released 2005-11-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli [TaxId:5698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44049 (14-End)
      • cloning artifact (11-13)
      • see remark 999 (63)
      • see remark 999 (199)
      • see remark 999 (385)
      • see remark 999 (619)
    Domains in SCOPe 2.05: d2a75a1, d2a75a2
  • Heterogens: SO4, FSI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a75A (A:)
    mggshhhhhhgmaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgv
    mvaiadaryetsfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnk
    lyilvgsfnktrnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpa
    efdgiltkefiggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrsk
    fgcsepavlewegkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdc
    qssfvavtiegkrvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssv
    lykddklyslheintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatpp
    skggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwp
    varqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwr
    plygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfy
    iggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a75A (A:)
    maslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefi
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatpkggcgaavptag
    lvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfa
    nyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgs
    welhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptds
    rvtvtnvvlynrrlnsseirtlflsqdmigtd