PDB entry 2a73

View 2a73 on RCSB PDB site
Description: Human Complement Component C3
Class: immune system
Keywords: intact thioester, immune system
Deposited on 2005-07-04, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.233
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a73A (A:)
    spmysiitpnilrleseetmvleahdaqgdvpvtvtvhdfpgkklvlssektvltpatnh
    mgnvtftipanrefksekgrnkfvtvqatfgtqvvekvvlvslqsgylfiqtdktiytpg
    stvlyriftvnhkllpvgrtvmvnienpegipvkqdslssqnqlgvlplswdipelvnmg
    qwkirayyenspqqvfstefevkeyvlpsfeviveptekfyyiynekglevtitarflyg
    kkvegtafvifgiqdgeqrislpeslkripiedgsgevvlsrkvlldgvqnlraedlvgk
    slyvsatvilhsgsdmvqaersgipivtspyqihftktpkyfkpgmpfdlmvfvtnpdgs
    payrvpvavqgedtvqsltqgdgvaklsinthpsqkplsitvrtkkqelseaeqatrtmq
    alpystvgnsnnylhlsvlrtelrpgetlnvnfllrmdraheakiryytylimnkgrllk
    agrqvrepgqdlvvlplsittdfipsfrlvayytligasgqrevvadsvwvdvkdscvgs
    lvvksgqsedrqpvpgqqmtlkiegdhgarvvlvavdkgvfvlnkknkltqskiwdvvek
    adigctpgsgkdyagvfsdagltftsssgqqtaqraelqcpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a73A (A:)
    spmysiitpnilrleseetmvleahdaqgdvpvtvtvhdfpgkklvlssektvltpatnh
    mgnvtftipanrernkfvtvqatfgtqvvekvvlvslqsgylfiqtdktiytpgstvlyr
    iftvnhkllpvgrtvmvnienpegipvkqdslssqnqlgvlplswdipelvnmgqwkira
    yyenspqqvfstefevkeyvlpsfeviveptekfyyiynekglevtitarflygkkvegt
    afvifgiqdgeqrislpeslkripiedgsgevvlsrkvlldgvlraedlvgkslyvsatv
    ilhsgsdmvqaersgipivtspyqihftktpkyfkpgmpfdlmvfvtnpdgspayrvpva
    vqgedtvqsltqgdgvaklsinthpsqkplsitvrtkkqelseaeqatrtmqalpystvg
    nsnnylhlsvlrtelrpgetlnvnfllrmdraheakiryytylimnkgrllkagrqvrep
    gqdlvvlplsittdfipsfrlvayytligasgqrevvadsvwvdvkdscvgslvvksgqs
    edrqpvpgqqmtlkiegdhgarvvlvavdkgvfvlnkknkltqskiwdvvekadigctpg
    sgkdyagvfsdagltftsssgqqtaqraelqcpqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a73B (B:)
    vqltekrmdkvgkypkelrkccedgmrenpmrfscqrrtrfislgeackkvfldccnyit
    elrrqharashlglarsnldediiaeenivsrsefpeswlwnvedlkeppkngistklmn
    iflkdsittweilavsmsdkkgicvadpfevtvmqdffidlrlpysvvrneqveiravly
    nyrqnqelkvrvellhnpafcslattkrrhqqtvtippksslsvpyvivplktglqevev
    kaavyhhfisdgvrkslkvvpegirmnktvavrtldperlgregvqkedippadlsdqvp
    dtesetrillqgtpvaqmtedavdaerlkhlivtpsgcgeqnmigmtptviavhyldete
    qwekfglekrqgalelikkgytqqlafrqpssafaafvkrapstwltayvvkvfslavnl
    iaidsqvlcgavkwlilekqkpdgvfqedapvihqemigglrnnnekdmaltafvlislq
    eakdiceeqvnslpgsitkagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflt
    takdknrwedpgkqlynveatsyallallqlkdfdfvppvvrwlneqryygggygstqat
    fmvfqalaqyqkdapdhqelnldvslqlpsrsskithrihwesasllrseetkenegftv
    taegkgqgtlsvvtmyhakakdqltcnkfdlkvtikpapetekrpqdakntmileictry
    rgdqdatmsildismmtgfapdtddlkqlangvdryiskyeldkafsdrntliiyldkvs
    hseddclafkvhqyfnveliqpgavkvyayynleesctrfyhpekedgklnklcrdelcr
    caeencfiqksddkvtleerldkacepgvdyvyktrlvkvqlsndfdeyimaieqtiksg
    sdevqvgqqrtfispikcrealkleekkhylmwglssdfwgekpnlsyiigkdtwvehwp
    eedecqdeenqkqcqdlgaftesmvvfgcpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a73B (B:)
    vqltekrmdkvgkypkelrkccedgmrenpmrfscqrrtrfislgeackkvfldccnyit
    elrrqharaldediiaeenivsrsefpeswlwnvedlkeppkngistklmniflkdsitt
    weilavsmsdkkgicvadpfevtvmqdffidlrlpysvvrneqveiravlynyrqnqelk
    vrvellhnpafcslattkrrhqqtvtippksslsvpyvivplktglqevevkaavyhhfi
    sdgvrkslkvvpegirmnktvavrtldperlgregvqkedippadlsdqvpdtesetril
    lqgtpvaqmtedavdaerlkhlivtpsgcgeqnmigmtptviavhyldeteqwekfglek
    rqgalelikkgytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlc
    gavkwlilekqkpdgvfqedapvihqennnekdmaltafvlislqeakdiceeqvnslpg
    sitkagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkql
    ynveatsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
    dhqelnldvslqlpsrsskithrihwesasllrseetkenegftvtaegkgqgtlsvvtm
    yhakakdqltcnkfdlkvtikpapetekrpqdakntmileictryrgdqdatmsildism
    mtgfapdtddlkqlangvdryiskyeldkafsdrntliiyldkvshseddclafkvhqyf
    nveliqpgavkvyayynleesctrfyhpekedgklnklcrdelcrcaeencfiqksddkv
    tleerldkacepgvdyvyktrlvkvqlsndfdeyimaieqtiksgsdevqvgqqrtfisp
    ikcrealkleekkhylmwglssdfwgekpnlsyiigkdtwvehwpeedecqdeenqkqcq
    dlgaftesmvvfgcpn