PDB entry 2a71

View 2a71 on RCSB PDB site
Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), orthorhombic crystal form
Class: sugar binding protein
Keywords: BETA SANDWICH, CARBOHYDRATE BINDING PROTEIN, CARGO RECEPTOR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, SUGAR BINDING PROTEIN
Deposited on 2005-07-04, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Emp47p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB CAA60953 (Start-221)
    Domains in SCOPe 2.08: d2a71a_
  • Chain 'B':
    Compound: Emp47p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB CAA60953 (Start-221)
    Domains in SCOPe 2.08: d2a71b_
  • Chain 'C':
    Compound: Emp47p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB CAA60953 (Start-221)
    Domains in SCOPe 2.08: d2a71c_
  • Chain 'D':
    Compound: Emp47p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB CAA60953 (Start-221)
    Domains in SCOPe 2.08: d2a71d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a71A (A:)
    gsdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlk
    dsftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgp
    tlrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvc
    fqtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a71A (A:)
    klssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsftm
    ewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlrgq
    lndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqtrk
    vrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a71B (B:)
    gsdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlk
    dsftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgp
    tlrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvc
    fqtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a71B (B:)
    asklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsf
    tmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlr
    gqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqt
    rkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a71C (C:)
    gsdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlk
    dsftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgp
    tlrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvc
    fqtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a71C (C:)
    klssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsftm
    ewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlrgq
    lndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqtrk
    vrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a71D (D:)
    gsdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlk
    dsftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgp
    tlrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvc
    fqtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a71D (D:)
    lssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsftme
    wtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlrgql
    ndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqtrkv
    rfpsgsyrigvtaqngavnnnaesfeifkmqffngv