PDB entry 2a70

View 2a70 on RCSB PDB site
Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), monoclinic crystal form 2
Class: sugar binding protein
Keywords: BETA SANDWICH, CARBOHYDRATE BINDING PROTEIN, CARGO RECEPTOR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, SUGAR BINDING PROTEIN
Deposited on 2005-07-04, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.135
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Emp47p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB CAA60953 (1-221)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2a70a2, d2a70a3
  • Chain 'B':
    Compound: Emp47p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB CAA60953 (1-221)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2a70b2, d2a70b3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a70A (A:)
    gsdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlk
    dsftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgp
    tlrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvc
    fqtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a70B (B:)
    gsdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlk
    dsftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgp
    tlrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvc
    fqtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv