PDB entry 2a6z

View 2a6z on RCSB PDB site
Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), monoclinic crystal form 1
Class: sugar binding protein
Keywords: BETA SANDWICH, CARBOHYDRATE BINDING PROTEIN, CARGO RECEPTOR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2005-07-04, released 2006-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.13
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Emp47p (form2)
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • GB CAA60953 (1-221)
    • cloning artifact (0)
  Domains in SCOP 1.73: d2a6za1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2a6zA (A:)
  gsdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlk
  dsftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgp
  tlrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvc
  fqtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv