PDB entry 2a6w

View 2a6w on RCSB PDB site
Description: Crystal structure of Emp46p carbohydrate recognition domain (CRD), metal-free form
Class: sugar binding protein
Keywords: BETA SANDWICH, CARBOHYDRATE BINDING PROTEIN, CARGO RECEPTOR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, SUGAR BINDING PROTEIN
Deposited on 2005-07-04, released 2006-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.211
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Emp46p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB NP_013181
    Domains in SCOPe 2.06: d2a6wa_
  • Chain 'B':
    Compound: Emp46p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB NP_013181
    Domains in SCOPe 2.06: d2a6wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a6wA (A:)
    gsdelkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpey
    sikdamtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddk
    lgesvtaylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrv
    cfqtrkvkfmgsspfrigtsaindaskesfeilkmklydgviedsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6wA (A:)
    lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd
    amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges
    vtaylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt
    rkvkfmspfrigtsaindaskesfeilkmklydgvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a6wB (B:)
    gsdelkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpey
    sikdamtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddk
    lgesvtaylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrv
    cfqtrkvkfmgsspfrigtsaindaskesfeilkmklydgviedsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6wB (B:)
    lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd
    amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges
    vtaylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt
    rkvkfmgsspfrigtsaindaskesfeilkmklydgvie