PDB entry 2a6v

View 2a6v on RCSB PDB site
Description: Crystal structure of Emp46p carbohydrate recognition domain (CRD), potassium-bound form
Class: sugar binding protein
Keywords: BETA SANDWICH, CARBOHYDRATE BINDING PROTEIN, CARGO RECEPTOR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, SUGAR BINDING PROTEIN
Deposited on 2005-07-04, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.191
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Emp46p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB NP_013181
    Domains in SCOPe 2.07: d2a6va1
  • Chain 'B':
    Compound: Emp46p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB NP_013181
    Domains in SCOPe 2.07: d2a6vb_
  • Heterogens: K, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a6vA (A:)
    gsdelkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpey
    sikdamtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddk
    lgesvtaylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrv
    cfqtrkvkfmgsspfrigtsaindaskesfeilkmklydgviedsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6vA (A:)
    kwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikda
    mtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklgesv
    taylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqtr
    kvkfmgsspfrigtsaindaskesfeilkmklydgvie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a6vB (B:)
    gsdelkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpey
    sikdamtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddk
    lgesvtaylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrv
    cfqtrkvkfmgsspfrigtsaindaskesfeilkmklydgviedsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6vB (B:)
    kwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikda
    mtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklgesv
    taylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqtr
    kvkfmgsspfrigtsaindaskesfeilkmklydgvi