PDB entry 2a6s

View 2a6s on RCSB PDB site
Description: Crystal structure of YoeB under isopropanol condition
Class: toxin
Keywords: YoeB, YefM, toxin, antitoxin, addiction modules, RNase, inhibitor
Deposited on 2005-07-04, released 2005-08-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.195
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6sa1
  • Chain 'B':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6sb1
  • Chain 'C':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6sc1
  • Chain 'D':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6sd1
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a6sA (A:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6sA (A:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6sB (B:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6sC (C:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a6sD (D:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6sD (D:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryh