PDB entry 2a6r

View 2a6r on RCSB PDB site
Description: Crystal structure of YoeB under PEG condition
Class: toxin
Keywords: YoeB, YefM, toxin, antitoxin, addiction modules, RNase, inhibitor
Deposited on 2005-07-04, released 2005-08-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6ra1
  • Chain 'B':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6rb1
  • Chain 'C':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6rc1
  • Chain 'D':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6rd1
  • Chain 'E':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6re1
  • Chain 'F':
    Compound: Toxin yoeB
    Species: Escherichia coli
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a6rf1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6rA (A:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6rB (B:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a6rC (C:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6rC (C:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6rD (D:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6rE (E:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6rF (F:)
    mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
    teehrlvyavtddslliaacryhy