PDB entry 2a6q

View 2a6q on RCSB PDB site
Description: Crystal structure of YefM-YoeB complex
Class: toxin inhibitor/toxin
Keywords: YoeB, YefM, toxin, antitoxin, addiction modules, RNase, inhibitor, TOXIN INHIBITOR-TOXIN COMPLEX
Deposited on 2005-07-04, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antitoxin yefM
    Species: Escherichia coli [TaxId:562]
    Gene: yefM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69346 (3-85)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2a6qa1, d2a6qa2
  • Chain 'B':
    Compound: Antitoxin yefM
    Species: Escherichia coli [TaxId:562]
    Gene: yefM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69346 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2a6qb1, d2a6qb2
  • Chain 'C':
    Compound: Antitoxin yefM
    Species: Escherichia coli [TaxId:562]
    Gene: yefM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69346 (3-85)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2a6qc2, d2a6qc3
  • Chain 'D':
    Compound: Antitoxin yefM
    Species: Escherichia coli [TaxId:562]
    Gene: yefM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69346 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2a6qd2, d2a6qd3
  • Chain 'E':
    Compound: Toxin yoeB
    Species: Escherichia coli [TaxId:562]
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a6qe1
  • Chain 'F':
    Compound: Toxin yoeB
    Species: Escherichia coli [TaxId:562]
    Gene: yoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a6qf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a6qA (A:)
gphmrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrs
panarrlmdsidslksgkgtekdiie

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2a6qB (B:)
gphmrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrs
panarrlmdsidslksgkgtekdiie

    Sequence, based on observed residues (ATOM records): (download) 
    >2a6qB (B:)
gphmrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayll

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a6qC (C:)
gphmrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrs
panarrlmdsidslksgkgtekdiie

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >2a6qD (D:)
gphmrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrs
panarrlmdsidslksgkgtekdiie

    Sequence, based on observed residues (ATOM records): (download) 
    >2a6qD (D:)
gphmrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayll

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a6qE (E:)
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryhy

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a6qF (F:)
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryhy