PDB entry 2a6o

View 2a6o on RCSB PDB site
Description: Crystal Structure of the ISHp608 Transposase in Complex with Stem-loop DNA
Class: transcription/DNA
Keywords: RNA Recognition Motif, DNA Stem-loop, TRANSCRIPTION-DNA COMPLEX
Deposited on 2005-07-03, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ISHp608 transposase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a6oa_
  • Chain 'B':
    Compound: ISHp608 transposase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a6ob_
  • Chain 'C':
    Compound: 5'-d(*cp*cp*cp*cp*tp*ap*gp*cp*tp*tp*tp*ap*gp*cp*tp*ap*tp*gp*gp*gp*gp*a)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*cp*cp*cp*tp*ap*gp*cp*tp*tp*tp*ap*gp*cp*tp*ap*tp*gp*gp*gp*gp*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a6oA (A:)
    msnavlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqt
    dkdhihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggap
    lnvvkqyienqqnsnrpkqkekwksyvdnlqtkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6oA (A:)
    avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
    hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
    vkqyienqqnsnrpkqkekwksyvdnlqtkal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a6oB (B:)
    msnavlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqt
    dkdhihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggap
    lnvvkqyienqqnsnrpkqkekwksyvdnlqtkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6oB (B:)
    avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
    hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
    vkqyienqqnsnrpkqkekwksyvdnlqtkal
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.