PDB entry 2a6n

View 2a6n on RCSB PDB site
Description: Dihydrodipicolinate synthase (E. coli)- mutant R138A
Class: lyase
Keywords: beta-alpha-barrel, dihydrodipicolinate synthase, LYASE
Deposited on 2005-07-03, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: dapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L2 (0-291)
      • engineered (137)
    Domains in SCOPe 2.07: d2a6na1
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: dapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L2 (0-291)
      • engineered (137)
    Domains in SCOPe 2.07: d2a6nb_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6nA (A:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsatgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6nB (B:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsatgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll