PDB entry 2a6m

View 2a6m on RCSB PDB site
Description: Crystal Structure of the ISHp608 Transposase
Class: transcription/DNA
Keywords: RNA Recognition Motif, TRANSCRIPTION/DNA COMPLEX
Deposited on 2005-07-03, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.254
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ISHp608 transposase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a6ma1
  • Chain 'B':
    Compound: ISHp608 transposase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a6mb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a6mA (A:)
    msnavlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqt
    dkdhihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggap
    lnvvkqyienqqnsnrpkqkekwksyvdnlqtkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6mA (A:)
    avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
    hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
    vkqyienqqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a6mB (B:)
    msnavlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqt
    dkdhihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggap
    lnvvkqyienqqnsnrpkqkekwksyvdnlqtkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6mB (B:)
    navlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdk
    dhihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggapln
    vvkqyienqqnsnrpkqkekwksyvdnlqt