PDB entry 2a6l

View 2a6l on RCSB PDB site
Description: Dihydrodipicolinate synthase (E. coli)- mutant R138H
Class: lyase
Keywords: beta-alpha-barrel, dihydrodipicolinate synthase, LYASE
Deposited on 2005-07-03, released 2005-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: dapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L2 (0-291)
      • engineered (137)
    Domains in SCOPe 2.08: d2a6la1
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: dapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L2 (0-291)
      • engineered (137)
    Domains in SCOPe 2.08: d2a6lb_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6lA (A:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpshtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6lB (B:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpshtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll