PDB entry 2a6k

View 2a6k on RCSB PDB site
Description: Crystal Structure Analysis of the germline antibody 36-65 Fab in complex with the dodecapeptide SLGDNLTNHNLR
Class: immune system
Keywords: Immunoglobulin fold, Fab-peptide complex, IMMUNE SYSTEM
Deposited on 2005-07-03, released 2006-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germline antibody 36-65 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6K (0-213)
  • Chain 'B':
    Compound: Germline antibody 36-65 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a6kb2, d2a6kb3
  • Chain 'H':
    Compound: Germline antibody 36-65 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a6kh2, d2a6kh3
  • Chain 'L':
    Compound: Germline antibody 36-65 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6K (0-213)
  • Chain 'P':
    Compound: dodecapeptide: slgdnltnhnlr
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6K (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a6kB (B:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6kB (B:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2a6kH (H:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6kH (H:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    No sequence available.

  • Chain 'P':
    No sequence available.