PDB entry 2a6i

View 2a6i on RCSB PDB site
Description: Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide KLASIPTHTSPL
Class: immune system
Keywords: Immunoglobulin fold, Fab-peptide complex, IMMUNE SYSTEM
Deposited on 2005-07-02, released 2006-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.245
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germline antibody 36-65 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6I (0-213)
  • Chain 'B':
    Compound: Germline antibody 36-65 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6I (0-221)
    Domains in SCOPe 2.06: d2a6ib2, d2a6ib3
  • Chain 'P':
    Compound: Dodecapeptide: KLASIPTHTSPL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2A6I (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a6iB (B:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6iB (B:)
    evqlqqsgaelvragssvkmsckasgytftsyginwvkqrpgqglewigyinpgngytky
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarsvyyggsyyfdywgqgttltvs
    sakttppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'P':
    No sequence available.