PDB entry 2a6e

View 2a6e on RCSB PDB site
Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
Class: transferase
Keywords: RNA POLYMERASE HOLOENZYME, BRIDGE HELIX, TRANSCRIPTION REGULATION, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2005-07-02, released 2005-09-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.231
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6ea1, d2a6ea2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6eb1, d2a6eb2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6ec_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase beta' chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6ed1
  • Chain 'E':
    Compound: RNA polymerase omega chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6ee_
  • Chain 'F':
    Compound: RNA polymerase sigma factor rpoD
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6ef1, d2a6ef2, d2a6ef3
  • Chain 'K':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6ek1, d2a6ek2
  • Chain 'L':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6el1, d2a6el2
  • Chain 'M':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6em_
  • Chain 'N':
    Compound: DNA-directed RNA polymerase beta' chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6en1
  • Chain 'O':
    Compound: RNA polymerase omega chain
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6eo_
  • Chain 'P':
    Compound: RNA polymerase sigma factor rpoD
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2a6ep1, d2a6ep2, d2a6ep3
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a6eA (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eA (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a6eB (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eB (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6eC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a6eD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eD (D:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
    laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
    rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
    ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
    rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
    pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
    kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
    qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
    sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
    tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
    kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
    avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
    nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
    shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
    lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
    cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
    qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
    kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
    qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
    wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
    aieearkeavea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2a6eE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    etwamkelltgrlvfgenlvpedrlqkemeriypgeree
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
    twamkelltgrlvfgenlvpedrlqkemeriypge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a6eF (F:)
    mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdlaleddlldlpeegeg
    ldleeeeedlpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseit
    gldpdlirevvrakilgsarvrhipglketldpktveeidqklkslpkehkrylhiareg
    eaarqhlieanlrlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyat
    wwirqainraiadqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwd
    akrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsk
    lsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrd
    fld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eF (F:)
    kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
    kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
    lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
    qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
    pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
    glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2a6eK (K:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eK (K:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2a6eL (L:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eL (L:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a6eM (M:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2a6eN (N:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eN (N:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
    laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
    rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
    ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
    rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
    pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
    kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
    qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
    sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
    tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
    kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
    avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
    nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
    shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
    lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
    cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
    qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
    kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
    qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
    wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
    aieearkeavea
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2a6eO (O:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    etwamkelltgrlvfgenlvpedrlqkemeriypgeree
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eO (O:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
    twamkelltgrlvfgenlvpedrlqkemeriypge
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2a6eP (P:)
    mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdlaleddlldlpeegeg
    ldleeeeedlpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseit
    gldpdlirevvrakilgsarvrhipglketldpktveeidqklkslpkehkrylhiareg
    eaarqhlieanlrlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyat
    wwirqainraiadqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwd
    akrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsk
    lsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrd
    fld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6eP (P:)
    kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
    kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
    lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
    qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
    pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
    glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld