PDB entry 2a6b

View 2a6b on RCSB PDB site
Description: Crystal structure of (np_358222.1) from STREPTOCOCCUS PNEUMONIAE R6 at 1.70 A resolution
Class: structural genomics, unknown function
Keywords: np_358222.1, , Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-07-02, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.155
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein spr0628
    Species: Streptococcus pneumoniae
    Gene: np_358222.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DQK6
      • modified residue (75)
      • modified residue (137)
      • modified residue (152)
    Domains in SCOP 1.73: d2a6ba1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a6bA (A:)
    mgsdkihhhhhhmetqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlk
    dyliqdyhffdaflsmlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaen
    dylevtlhpvtkafqdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsew
    inlhrgpffaewvqflvdelnrvgknredltelqqrwnqavalelaffdigydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a6bA (A:)
    tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
    smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
    qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
    flvdelnrvgknredltelqqrwnqavalelaffdigyd