PDB entry 2a66

View 2a66 on RCSB PDB site
Description: Human Liver Receptor Homologue DNA-Binding Domain (hLRH-1 DBD) in Complex with dsDNA from the hCYP7A1 Promoter
Class: transcription/DNA
Keywords: nuclear receptor, protein-DNA complex, zinc finger, DNA-binding domain, transcription factor, Ftz-F1, C-terminal extension, TRANSCRIPTION-DNA COMPLEX
Deposited on 2005-07-01, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orphan nuclear receptor NR5A2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2, B1F, CPF, FTF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a66a_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*tp*cp*ap*ap*gp*gp*cp*cp*ap*g)-3'
    Species: Homo sapiens [TaxId:9606]
  • Chain 'C':
    Compound: 5'-d(*cp*tp*gp*gp*cp*cp*tp*tp*gp*ap*ap*c)-3'
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a66A (A:)
    gefgdedleelcpvcgdkvsgyhyglltcesckgffkrtvqnnkrytcienqncqidktq
    rkrcpycrfqkclsvgmkleavradrmrggrnkfgpmykrdralkqqkkalir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a66A (A:)
    elcpvcgdkvsgyhyglltcesckgffkrtvqnnkrytcienqncqidktqrkrcpycrf
    qkclsvgmkleavradrmrggrnkfgpmykrdral
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.