PDB entry 2a5z

View 2a5z on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function SO2946 from Shewanella oneidensis MR-1
Class: structural genomics, unknown function
Keywords: Shewanella oneidensis MR-1, hypothetical protein, SO2946, Structural Genomics , PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-07-01, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.168
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SO2946
    Species: Shewanella oneidensis MR-1
    Gene: SO2946
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ED25 (Start-261)
      • modified residue (28)
      • modified residue (55-56)
      • modified residue (106)
      • modified residue (108)
      • modified residue (190)
      • modified residue (217)
    Domains in SCOP 1.73: d2a5za1
  • Chain 'B':
    Compound: hypothetical protein SO2946
    Species: Shewanella oneidensis MR-1
    Gene: SO2946
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ED25 (Start-261)
      • modified residue (28)
      • modified residue (55-56)
      • modified residue (106)
      • modified residue (108)
      • modified residue (190)
      • modified residue (217)
    Domains in SCOP 1.73: d2a5zb1
  • Chain 'C':
    Compound: hypothetical protein SO2946
    Species: Shewanella oneidensis MR-1
    Gene: SO2946
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ED25 (Start-261)
      • modified residue (28)
      • modified residue (55-56)
      • modified residue (106)
      • modified residue (108)
      • modified residue (190)
      • modified residue (217)
    Domains in SCOP 1.73: d2a5zc1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a5zA (A:)
    mggsfgkkgassataaqvplatettpglmspseklklstlttsiatsdfyasydfmmhsi
    gltsannisllstgnislqnilsegnhfgvqpivssttanasflagmlmaifpkeselev
    tvyfktpsafnpaqltvigstsiglgisdrsgliiengnafggivkasaatetgstyals
    tstwyickfkmltddrfkvtlysdsgtqlysytstaamfradnatahigfktqcktatag
    islisidliefkakvsatrakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5zA (A:)
    ttpglmspseklklstlttsiatsdfyasydfmmhsigltsannisllstgnislqnils
    egnhfgvqpivssttanasflagmlmaifpkeselevtvyfktpsafnpaqltvigstsi
    glgisdrsgliiengnafggivkasaatetgstyalststwyickfkmltddrfkvtlys
    dsgtqlysytstaamfradnatahigfktqcktatagislisidliefkakvsatrakv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a5zB (B:)
    mggsfgkkgassataaqvplatettpglmspseklklstlttsiatsdfyasydfmmhsi
    gltsannisllstgnislqnilsegnhfgvqpivssttanasflagmlmaifpkeselev
    tvyfktpsafnpaqltvigstsiglgisdrsgliiengnafggivkasaatetgstyals
    tstwyickfkmltddrfkvtlysdsgtqlysytstaamfradnatahigfktqcktatag
    islisidliefkakvsatrakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5zB (B:)
    ttpglmspseklklstlttsiatsdfyasydfmmhsigltsannisllstgnislqnils
    egnhfgvqpivssttanasflagmlmaifpkeselevtvyfktpsafnpaqltvigstsi
    glgisdrsgliiengnafggivkasaatetgstyalststwyickfkmltddrfkvtlys
    dsgtqlysytstaamfradnatahigfktqcktatagislisidliefkakvsatrakv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a5zC (C:)
    mggsfgkkgassataaqvplatettpglmspseklklstlttsiatsdfyasydfmmhsi
    gltsannisllstgnislqnilsegnhfgvqpivssttanasflagmlmaifpkeselev
    tvyfktpsafnpaqltvigstsiglgisdrsgliiengnafggivkasaatetgstyals
    tstwyickfkmltddrfkvtlysdsgtqlysytstaamfradnatahigfktqcktatag
    islisidliefkakvsatrakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5zC (C:)
    platettpglmspseklklstlttsiatsdfyasydfmmhsigltsannisllstgnisl
    qnilsegnhfgvqpivssttanasflagmlmaifpkeselevtvyfktpsafnpaqltvi
    gstsiglgisdrsgliiengnafggivkasaatetgstyalststwyickfkmltddrfk
    vtlysdsgtqlysytstaamfradnatahigfktqcktatagislisidliefkakvsat
    rakv