PDB entry 2a5t

View 2a5t on RCSB PDB site
Description: Crystal Structure Of The NR1/NR2A ligand-binding cores complex
Class: metal transport,membrane protein
Keywords: Protein-ligand complex, METAL TRANSPORT, MEMBRANE PROTEIN
Deposited on 2005-06-30, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-methyl-D-aspartate receptor NMDAR1-4a subunit
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35439 (Start-151)
      • conflict (128)
      • see remark 999 (152-153)
    • GB AAB50932 (154-End)
    Domains in SCOPe 2.08: d2a5ta_
  • Chain 'B':
    Compound: N-methyl-D-aspartate receptor NMDAR2A subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00959 (Start-139)
      • see remark 999 (140-141)
    • GB AAB58801 (142-End)
    Domains in SCOPe 2.08: d2a5tb_
  • Heterogens: GLY, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a5tA (A:)
    gmstrlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvp
    qccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadm
    ivapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqss
    vdiyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvt
    tgelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5tA (A:)
    trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpntvpqccygfcidlli
    klartmnftyevhlvadgkfgtqervkkewngmmgellsgqadmivapltinneraqyie
    fskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyr
    hmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrk
    dspwkqnvslsilkshengfmedldktwvry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a5tB (B:)
    gpddnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgf
    cidilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineers
    evvdfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnny
    pymhqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifat
    tgygialqkgspwkrqidlallqfvgdgemeeletlwltgichn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5tB (B:)
    nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
    lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
    fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
    qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigyifattgygia
    lqkgspwkrqidlallqfvgdgemeeletlwltgic