PDB entry 2a5l

View 2a5l on RCSB PDB site
Description: The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
Class: transcription
Keywords: APC5760, PA0949, PROTEIN STRUCTURE INITIATIVE, PSI, repressor binding protein, Structural Genomics, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-06-30, released 2005-07-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trp repressor binding protein WrbA
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • GB NP_249640 (Start-199)
      • modified residue (21)
      • modified residue (85)
      • modified residue (130)
      • modified residue (139)
    Domains in SCOP 1.73: d2a5la1
  • Chain 'B':
    Compound: Trp repressor binding protein WrbA
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • GB NP_249640 (Start-199)
      • modified residue (21)
      • modified residue (85)
      • modified residue (130)
      • modified residue (139)
    Domains in SCOP 1.73: d2a5lb1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a5lA (A:)
    gsmsspyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaeg
    alyatledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstasl
    hggqettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldehe
    ltlcralgkrlaetagklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5lA (A:)
    spyilvlyysrhgataemarqiargveqggfearvrtvpavstalyatledlkncaglal
    gsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllh
    hgmlvlgipytpygashfagadgkrsldeheltlcralgkrlaetagklgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a5lB (B:)
    gsmsspyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaeg
    alyatledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstasl
    hggqettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldehe
    ltlcralgkrlaetagklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5lB (B:)
    spyilvlyysrhgataemarqiargveqggfearvrtvpavstealyatledlkncagla
    lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll
    hhgmlvlgipyseptpygashfagadgkrsldeheltlcralgkrlaetagklgs