PDB entry 2a5j

View 2a5j on RCSB PDB site
Description: Crystal Structure of Human RAB2B
Class: protein transport
Keywords: GTPase, Signal transduction, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN TRANSPORT
Deposited on 2005-06-30, released 2005-07-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-2B
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WUD1 (19-190)
      • expression tag (9)
      • cloning artifact (10-18)
    Domains in SCOPe 2.05: d2a5ja1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a5jA (A:)
    mgsshhhhhhssglvprgsylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefga
    rmvnidgkqiklqiwdtagqesfrsitrsyyrgaagallvyditrretfnhltswledar
    qhsssnmvimlignksdlesrrdvkreegeafarehglifmetsaktacnveeafintak
    eiyrkiqqglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a5jA (A:)
    hssglvprgsylfkyiiigdtgvgksclllqftdkrfqpigvefgarmvnidgkqiklqi
    wdtagqesfrsitrsyyrgaagallvyditrretfnhltswledarqhsssnmvimlign
    ksdlesrrdvkreegeafarehglifmetsaktacnveeafintakeiyrkiqqglf